MOON
Server: Apache
System: Linux vps.thepromohut.com 2.6.18-398.el5 #1 SMP Tue Sep 16 20:51:48 EDT 2014 i686
User: caretrak (507)
PHP: 5.2.10
Disabled: NONE
Upload Files
File: //proc/self/root/usr/bin/sigtool
ELF4(4 (444444!!!d!HHH  Ptd<<Qtd/lib/ld-linux.so.2GNU	!
|(CEK8qXfUa2R4d]I
z&v&2={<.1{ J	&d=
  nDt50{]~g3v	<raz2qKzqm='?CE1
FzWRHDAqN=6mpWTW<p=<W9'.829f5TK8^t"]94bc+a[No`_F^1 #R|/BBC)nh_
I.vYEuDM8>||4I2 ?*39;fMRgE88%W:W`?]BdHD,dXp
q
T%libssl.so.6__gmon_start___Jv_RegisterClassesEVP_sha256EVP_DigestInit_exEVP_DigestFinal_exEVP_DigestUpdate_finilibcrypto.so.6EVP_MD_CTX_createEVP_MD_CTX_destroylibclamav.so.6gzclosegzdopengzgetscli_ctimecli_isnumbercl_finish_hashcli_rmdirscl_hash_destroycl_engine_newcli_wm_readdircli_filecopycli_gentempcli_chompcl_cleanup_cryptocli_regcompcl_cvdfreecli_parse_addcli_ac_chklsigcl_initcli_str2hexcli_calloccli_strtokcli_strbcasestrcli_versig2cl_strerrorcli_regexeccli_wm_decrypt_macrocl_debugcl_engine_freecli_gettmpdircli_hashfilecli_malloccli_hex2uicl_engine_set_numcl_cvdheadcl_update_hashcli_hashstreamcli_cvdunpackcl_retflevelcl_cvdverifycli_strtokenizecli_initrootscl_engine_compilecl_initialize_cryptocli_vba_readdircli_fmap_scandesccl_sha1cl_loadcli_regfreecli_ppt_vba_readhtml_normalise_mapcli_vba_inflatecl_retdbdircl_hash_initcli_ole2_extractuniq_getcli_hex2strcli_checkfp_pefmapcli_utf16toasciilibz.so.1gzopengzwritelibresolv.so.2libpthread.so.0__errno_locationforklseekconnectsendrecvfcntllibc.so.6_IO_stdin_usedsocket__xpg_basenamefflushstrcpy__printf_chkexitsetlocalefopenstrncmpoptindstrrchr__strdupperrorclosedirftellstrncpy__stack_chk_failunlinkselectmkdirreallocstdinstrpbrkstrftimerewindlocaltime_rfgetsstrlenmemsetstrstrtcsetattrfseekchdir__syslog_chkdup2__fxstat64__fprintf_chkstdoutfputcinet_addrfputsmemcpyfclose__strtol_internal__vsnprintf_chkumaskstrcasecmp__lxstat64opendir__xstat64getenv__ctype_b_locsscanfoptargstderr__snprintf_chkoptopt__fxstatfilenogetcwdfwritefreadrenamelocaltimestrchrfdopenqsorttcgetattrsleepsetsid__sprintf_chkaccessopterr__strcat_chkstrcmp__libc_start_maincloselog__strtoul_internal_edata__bss_start_endGLIBC_2.0CLAMAV_PUBLICCLAMAV_PRIVATEGLIBC_2.4GLIBC_2.3GLIBC_2.1GLIBC_2.2GLIBC_2.3.4	

 ii
0Ӈ_)E7>ii

Fii
	Pii
Zii
dti	nii
Ȳ̲вԲزܲ	

 $(,048<@ D!H"L#P$T%X&\'`(d)h*l+p,t-x.|/0123456789:;<=>?@ijAȳB̳CгDԳEسFܳGHIJKLMNOPQRSTUVW X$Y(Z,[0\4]8^<_@`DaHbLcPdTeXf\g`hdihjlkpltmxn|opqrstuvwxyz{|}~Ĵȴ̴дԴشܴ $(,048<@DUI

k5%IJ%Ȳh%̲h%вh%Բh%زh %ܲh(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h% h%$hp%(h`%,hP%0h@%4h0%8h %<h%@h%Dh%Hh%Lh%Ph%Th%Xh %\h(%`h0%dh8p%hh@`%lhHP%phP@%thX0%xh` %|hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%ijh%ȳh%̳h%гh%Գh%سh %ܳh(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h% h%$hp%(h`%,hP%0h@%4h0%8h %<h%@h%Dh%Hh%Lh%Ph%Th%Xh %\h(%`h0%dh8p%hh@`%lhHP%phP@%thX0%xh` %|hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%Ĵh%ȴh%̴h%дh%Դh%شh %ܴh(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h% h%$hp%(h`%,hP%0h@%4h0%8h %<h%@h%Dh1^PTRhphQVh hUS[tX[ÐUS=u?-X9v&9w[]Ít&'Utt	$ÐUVSut01tt$$vu[^]Ã[^]UWVS<ueE1f=tEe3<[^_]Ð4$EDžǃtE19v:<%u3<l<s<fy
9wƋ_DžDžED$t$D$D$\$<$D<!<@t~f=;9$8B$_f=tQGD$D$LD$$\<^<*ts<~t}<$D$5뢃H$ljDžf=D$G$^$f=f=uGD$D$VD$$[
fUWVSueE1<$?<*U4$Džǃ tL1&9s:<%u3<l<s<f
9rƋ DžED$t$D$D$|$$DtO~E$D$T$$t&5TP9	&
}f=f:*uЉ$D$ t$$:! t€҃)D
t$D$D$$<!0<^<*tG<$tB<#t><~t:D$$;f=%D$$Zfu
$sf=Nt!:#tT$$_6f=w1Ue3[^_]Ë$1ӋB"$f=낉<$jG,$<!.<^<*<$f<#<~D$D$_D$$f=f=eD$VD$D$${69f=u[tIt$L$\$D$bD$$5D$aD$$`D$f$*$pD$$~D$$c$D$G$T$D$})؉t$$t$,\$$$	4f=!D$_D$$D$$D$*á$$gf=L"TЃD$D$LD$$aD$_D$$D$C44D$D$;D$$ėsvЃD$D$_D$$DžDžDžDžfDž$p\$D$$~8_vuH$:D$D$BD$$.D$$D$wS$t&D$D$D$Fvŋ$p$XUf=u t$'Ívsى'UWVS]eE1U$=Dž\ƃ`tE19v:<;%u<l<s<f+\
9wƋ\`=XDžHLDžXELD$X\$D$D$D$$FPLD0PXw`Ue3P;[^_]Ã\B$\H$m됃\X$zXHLLDžXP9XwXPP1/PUTE@U<d84)TLTPLD$T$UD$$dy8DP1 DžiD8uً4󫋅<@dT$8dD$D$D$$&| Xw	PH$UWVSL$s(+1E+
T}U<}<5uBX$M<?>&t9uB
EB<:
W
T]<jATS=T9}}E:-uB<-+R-oU]ʋMMv;]8-uxt}EUT|$D$$U9]؉
T؋}]M܍|\]}MȋMP9E܉ӉU	Mԉʉ}}A;EuEUԋMmmm9M؉E뢀zEUMD$T$$Ƌ]9T~TL[^_]ÍC?T̋Ut$D$D$D$$T<;EȀ8My:C9ETX}::ifEؾT EM<:E€+t	-}:M:MP;]CTEؾTw}܉=T롋}CTT]t$D$D$D$$mUWVS|}EEUUMEU$+1E+5TEu9BE4u>-[u؋uF<->/<-t
ExR}E?-U҈U=]̋EE]EP҈UxM9]+]EE]܉E$^9EEԋ^E@uу}|uԅ|
XE?%v~EETu;5T}5TE|[^_]f+Et-vE]ȃE4v;]t8-uxt|$UTT$M$MUE9]ȉEb=TEu}D)߉E؉u}MPuU	9Mĉ|t&ʉ}}A9uEUċMm9MȉE<-]\$ut$}<$EWS93u2u<:uϋ}1<::ŋM1]	:ˆM+t	-}:]:]PE M̉Mf]1t&E܉D$U؉<$T$BuEuЋ{u~-}Xz}Eȉ|$UTD$D$D$$&E?d<;Eȋ}E=TH=izMEȉL$]TD$ؙD$|ML$]\$u4$EEEE}=EЋU{}tUЋESCETyEUMEUM|[^_]iE܉D$U؉$T$MEM)]EETEЋMCu[XuvE?nEȃ9ETJ1}:L:XMurE:[]f(u}D>}D$]D$ D$D$$YD$uD$PD$D$$]t&US]UEM]]E][]I'US]UEM]]E][]UVSÃt4tt$$tCtt$$t[(ũ[^]ÍvUVS]ut4tt$$tCtt$$mt[(ũ[^]ÐUWVS}W,t(t$zW,u$ew$t8Ftd$MF$BF$7^$4$,ޅuȋ$G$G$_(<$t	뎋v$댃[^_]Í&'UWVSUEEUE$0ø4$QMU$1CUE$CCEUCSvDCEC$C(CCEC,C tPX(1[^_]Ãv뵍t&MKUCZCCdUC(1[^_]ËC$$w$oz'U(u֋U}ϋM]UM@t]HtC$<$CEUCSsCt#C1]u}]ËS1tfCSw̃w1CD$0$t<$-FUMVډN‹B$ur$Xt$D$xD$$PDD$"D$$D$D$"D$$ȚD$rD$"D$$D$C4$'UW1V1SLEEEt&t*Ut60\C$U!u΋UtׅEtҋUuˉ|$C D$CSD$T$CUD$C$E
yD$?D$$D$iE$L1[^_]ËCiMUE5@ 4@E5\tEF$Et=Eu8EtD$D$D$D$$N딍t&F%Eu;ErD$D$D$D$$BE4$D$USMD$ěD$L$$EUD$D$\T$D$$sVtfF }ԉT$<$D$CD$D$D$U<$T$<$*FuUEEUȋM̋E$L$MU9EL[^_]ËED$FD$(D$D$$uD$8U$]tJM?
:u@
:At0D$<E$,EEE3EEEEt:D$D$
D$U$kEEȉMEE}tٍED$D$D$E$k1Ƀ;"E<M7%C<KUD$D$T$$(FD$ԜD$D$$MD$lD$L$$D$.D$$,D$EEEFE"MD$D$L$$>1ɉUȉMEI<kt<m|t&w	EEE|?h

Ǎ&'UWVS|
] EUe5u1ۉDžpDžltp11ƅx:DžDž&t:tF0\C$U!uUtׅEtҋut$C D$CSD$T$ClD$C$p{D$?D$$D$
p$1]e3|
[^_]Í&C?D$$itxDžDžDžxD$$t$xhы! t€u҃+A19xˉ 	{h4$f8#,AI
J@K҈e=L	Ӌ9t39t,{9t9t9uÅb{<$1Ƀ;/	T 	$L\Ȁ t	t	
uߋU>Džt$! pCtiwC *{tCDŽ*DŽ*C*Cux{Ƅx:C CƄx:DŽ(LUt7GFD$GD$D$D$$TtD$ExDžt\$|$t$$o;:	ot(
ɉ)p>P@ <@E=\t^G$EtVEuQM{t$D$D$D$$CIG%EE\$D$D$D$$9WxˉgD$)D$$HD$	GttG uXD$$T$PXD$D$D$t$$X$.ZGs[$pL$=Dž9}xD$1D$$D$WӋ9099up4$D$~	D$ěD$N8D$84$t5?
:u@
:Ft4$1D$<11Ʌ11D$*D$$tD$Yր:"WZD$"$ހ;.ED$pD$T$D$$DžfD$$SD$4$@~,1;1;\8;uÉD$D$ԞD$$Dž>M)D$t$뽋ƄxDžDŽ(DŽ(DŽ(DŽ(1vpT;U)ED$$6G,pG,5T9u;uh+T_,$qp+TG,uD$D$$D$"D$\$St^4$1D$D$
D$u*ZD$I$11<)tՍh4$1D$D$D$Ë8"h<M<K8D$D$T$$hEGD$GD$tD$D$$!D>GD$GD$<D$<ki<m)"8"m1	غtډ1GD$D$D$$asEhD$\T$\$T]<D$ԝD$D$3D$$D$[DžtVD$ěT$xtID$l\$Wt$GD$(D$GD$ԜD$%GtlD$GD$ПD$gtcT$D$D$$1cGD$|D$GD$D$wGaD$GD$0D$D$$닡D$D$$|D$~"|?w

GD$HD$D$$|EvBE
D$4\$t$GtpD$GD$D$D$$蔿D$D$$LD$DžGD$.GD$D$D$$+KUR]ÍUE]8/
UWV1SeE1ED$$u41#Ɖ\$D$<$ƿuډ$JUe3u[^_]|t&UH]E]}ueU1҉D$\$<$t#Ue3]u}]Ít&$|/taD$$T$ɾED$D$D$\$<$<$pvD$RD$D$D$D$$EU'UWVS,D$$RKED$$R4ED$$R}Etj}td1ۃt]t\$4$5u߳D}ut[v#,1[^_]Ð1D$D$$SD$Dt$u,[^_]Ív$v\$1ۉt$D$SD$$<$LDxt$W
U]&U=1҃Lw31D$MD$hSD$D$$XɉÍ&U8u}]D$D$D$D$D$D$$>yD$s$PEu!<$Z4$؋u]}]ËX<$\$"t̉$ƾ<$輾D$UËBD$0SD$D$D$$D$$dD$$L$|E|$D$0SD$D$$}D$$D$$$E$rUBU;BvExU$ӼU$ȼ<$Ð$+vUBD$=SD$D$D$$$Ex둉|$D$=SD$D$$vUWVS,]Er$$躾\$D$0SD$D$$D$4$蜻1\$D$=SD$D$4$޿D$4$^MtBE$\$|$D$US$D$脸4$輺,[^_]D$JS$D$Wы]uҋE$胺ʼn4$	iH9s@ωE$غM4$ۻx@$E谺ÉE|,D$JS$D$輷;E$t&t&'U(uu}}]D$4$Ë@tk5D$$D$$跺t
t6
t1V,]Ћu}]ƀD$C$\PCD$SD$D$$t16떐t&1덡$藹1yUSÃt-$q@$]SB$CLCu݋CCtY@$,SB$CCu݋Ct6t&@$C@$SB$C޷Cuσ[]É'U]Éu։}t11u)1t=tB4$RÉ؋u]}]9t< u4;u1͐t&;t< t; tPu9t)Aω$OtÉ|$t$$Ip&UWVS,U1҉M1ɉEEb11۾bfbtwU$T$Fuڋt^bE$dED$ED$UT$E$Ӆu@U$8,1[^_]ËE$TD$cU$,[^_]ËU$hTT$8E$$SE$<TD$뛍vUWVSEE$1ܶE'2ӋPt,T$$bGu;ut1>.u˺.$Tw<$'[^_]É<$蒶tB<$1[^_]ÉD$$T3[^_]$T멉|$$0U<$賴늍t&UVSEut@D$$葲t;VXtBF1[^]ÉFF1[^]$TU聾$Un$
UWVSE%U{<$1,E'肴ӋPt,T$$b藱u;ut1>.u˺.$Vǽ<$w[^_]ËE81[^_]É|$D$$U菽<$?[^_]$Un뭍&UWVS ueE1]Dž DžDžDžDžDžDž4$輳HE$迵  $藵$$f4HD$*$Dž<Dž@<&\$D$<$\<<$迱t<#t44$@눋bmD$D$b$D=T$$[mDž $$4$h@<$\T$|$1Ue3 [^_]ËHD$D$<$iHD$<$D$ HD$^|$$覯=^]t& <:u$<WLH<$薲 $$$گ<$|[T$+$諰<$蝯4$華؉8gHXD$$|$^))‰DRHD$D$<$臭L褬L1D$<$D$-09DLމD$D$$詴HD$ |$$L]D$\$$蘳L<$z8D$bD$W$D$(H1D$D$$DžPut&tEHD$D$<$,~.:uÃPPuD$ƄD$b$#bHD$*$D08Dž<Dž@uA4$i@+(9vCD$0|$$^<$<<$(虬t<#gbuD$D$b$W=2T$$[{Dž !T$$r4<$ƋD$X//$H[D$3$賬	/u^4$蔫4$膫D$$[贵s46<$0$"V$ZTH$螭 <$$$)DDLD$|$$谰&<$ZD$ڴ0<$Y$0<$=Jt$$XV萴|D$^$WrH$輬<$4<$:G$V3H$}H$[T$H<$O$<$|[|$ӳ0$R$K$V蠳H$<$BvD$$Vl<$輫T$$_4<$D$AƋ..u't#4$\Z$H[D$Ҳ0$Q	.u$W苲@$04$(\H$Z|$P$W?Hn$WH$pWU1ɉWVS}D$D$
D$$D$jD$$[t{UX0Jt9;1r/;1vQҍvt;2r
;1wQuPA1[^_]ËUHB1[^_]$L\$x\$\$訦뷉'U1ɉWVS}D$D$
D$$$$EI1ɺstl\tMD$$*taMXpEYtMAPEP1[^_]ÉQ4$ɥ$]$\$4]߯4$菥$臥뢐&UWVS,UURU܋URUUzU	D$*$蟦ES$cED$bU$jEE6UT$ED$U$?'EEt
UE9trt7;uUT$E$ѠuE$聥U$vE$U$^T$蠮E$M,[^_]ËZ$蕥\$D$U$E@E$t&_$]\$D$U$躨ED$G$;U$
T$uE$蕤U$芤}U$
UD$E$ U$Cu܅teD$bU$藤+t&\$U܋B$Ft<\$$
Qt'E܋@Eulj$ףEG1,[^_]É$轣U$^D$,[^_]$^׬E$U$y륋E$gU$\E$ѣU$FUD$E$0^D$rSU$E$
U$E$Ut$$d^D$#U$]D$E$]D$U$蔢E$艡$]軫E$hU$^D$葫$l]耫aUD$E$ _D$ZU$臢E$%U$L_D$%t&'UWVS<Eu1ɺD$D$
D$$GE$l1ɺD$D$
D$$Eԉ$)E9E1ɺGE^1ɺ.E71ɺED$*E؉$/1ɺE?D$bE܉$$cCEhD$bE1ۉ$àE|$ED$E$袝;]ED$E$Lut)4$E܉$E$E$ڞE؉$Ϟ<$ǟE$輟E$1E$aD$E$蓞<[^_]ËE$۟D$ED$E$5t&t$E$艚;]t"|$ED$E$蕜tu4$E܉$E$E$PD$ED$E$誢E1$ŝxE$赝E$誝E؉$蟝<$藞4$菞E$脞E$E$nE$aD$裧E܉$P<[^_]É<$;E$0E؉$蝞E؉D$E$袛fE؉$E$<1[^_]ÉD$$_<[^_]ËE$豜E$覜E؉$蛜<$蓝E܉$舜4$耝E$uE$E$_\$$a藦E$:E؉$/<$$`f4$E$E$E$kE$E܉D$E$bD$E؉$軛E܉$谛[$,`E$_̥/$_趥E$haD$虥E$FE$;E؉$0<$(E܉$4$E$
$8a<E$E$ޚE؉$Ӛ<$˛E܉$4$踛cE$aD$E$萚E$腚E؉$z<$rE܉$g$`虤E$FE$;E؉$0<$(E$`D$SE$E$E؉$$`E$əE$辙i$X`E$蝙HE؉D$E$XbD$E؉$nE$E$XE$4bD$胣UWVS"EueU1D$4$tND$\$$/<$D$D$xt$uD$d$ۖƅSD$@cD$D$lD$D$$\19uD$D$CcD$D$D$$aD$T$$t>D$ |$$$~etBt$|$$辗u‰$2Ue3mĜ"[^_]ËEt$|$$迕9t뿉$1҉%	u1뭍Dž|D$D$$ҕ߉1)%1))||L$T$$ӖmUD$D$$ޔ=߉1)%1))||EL$T$$耔l1[U]]uuCP$P8x4$CP$ԕC$u]]]鸕U$`]u}͘tUƉGtU$ÉGPtXED$D$$tW]u}]$Hc1V$ZcH<$1$oc04$<$1$cGP$Ӎt&'UWVStp$Ht$cD$۞Ĝ[^_]c9u#c:Cuc:C&t$誕$蠕D$D$L\$tD$cD$D$D$4$贘ED$t$$tE%=@tn=4$趓<$^t8tPXc9c:C<$&uȉ<$1Ĝ[^_]Ëpvt4$=<$ŕE$xD$$螏D$4$V|P$EED$ED$x$踕uEtD$pD$x$gED$|$bx$ܔx$N$c]4$5<$踔$蛕D$c$D$ÏED$|$x$`x$ґ<$Z4$‘*4$赑|$G<$*x$茑t$D$$/4$g뾋xD$$D$4$:<$“x$$&UWVSUEe
M1D$dhD$D$c$ttttdhD$T$$肏|txS@DžlDžxx14||$xD$A$D$cD$D$D$D$ED$$[t||D$xB$D$茒$RtF4$D$Ë\$D$d$5$mt&|xB;<|llx9J|$|B$	|A$|B$|$َttdD$D$D$c$݋dD$D$D$c$請Yh$ߎ2h$ldD$wUe3hļ[^_]Ãph|$D$cL$D$D$D$D$$轒ED$$tD$$肓tU$$t4$	]p$$CF$8F$-F$"F$F$4$D$cD$D$hL$D$D$D$$褑ED$$pt$mX1FFT$D$FpD$$tA$D$qË\$D$d$證$9~sxc:Fc9uc:Fh$4$D$D$蜉t$D$cD$D$Ëh$D$D$\$$Bt%=@tn$<$車t4tPpc9(p$x<$[1c:Ft
dM$T$L$|tUWVS,eE1D$$ņ1ۍDž
9uD$|$4$x~$1Ҁ<:
u9}
Ļ뽃tE4$背Ue3uM,[^_]Ë$dD$̋$dT$4$(̌t&UEEEE]&UW1VSÁ<D$eE1$5PjD$$@D$$P?T$D$D$D$D$D$4$詍D$4$teD$$荪P#T$D$D$&D$D$D$4$HD$4$興$"1D$$D$@4$D$3ED$c4$1҃ЋUe3u|<[^_]ÍvD$$谩x~tfD$$艩|$@$dD$Ž$\끋蕊t$$e荎W뒍t&'U($]u։}ljMZD$!<$Xt<t_E9#\$|$4$3]u}]Éٍt&D$+<$uD$u<$t뚍C$裉tƉ\$|$$蚄U؃9~0뇍&'UWVSÁL $?eE1衄DžD$*$]tD$ D$$D$t\$T$<$хt봍E1D$<$8$A蜈Ét&D.Ѓ$D$0D$D$D$ ű$Ue3uL [^_]D\$$0e<<$范Dž뺋$…몐&UWVSÁ\EeU1fEEEE$5oD$ED$$zED$D$$躄"fE$2fEMD$<$EED$bBD$D$4$wfrfE‰D$D$ލT$+]D$D$\$4$a! t€vҋU)T$$T$UED$t$<$؉D$~D$D$4$蒁EEEEEEEfED$D$$CD$D$\$<$gƄD$$م! t€tf҃)ٍAD$$0f\<$蜄$訇Ue3\[^_]Ðt&t&뒋E‰D$D$ˍT$u$?ۈt$$裀pEHELEPETETXE\E`EdEhElEpEtExE|EEHD$D$$"D$$ԀtxU‰$D$D$~E$ht$D$$谄x$R蔇E‰D$D$T$$et$D$$U1$R$Te.1EEEEEEEfE$~<$$\$$tĕ$e辆<$D$D$4$~k$Tf荆<$́1>$er\$$fb<$袁1$JG1$h41 $hUWVSLE؉UԉMD$$~D$E؉$[{D$Uԉ$>{WD$4$4$8~$0~EƋE9؉EI}̃<$EB<$EE<$TED$D$D$UЉ$zD$*Mԉ$~ED$*E؉$~EEE|$D$U${XU$~vMT

M$|EM|$L$E܉$M{EU܉$|M܉L$E$d[U$~EËE|$4$D$zE4$a|}M4$L$u\$1D$E$}|$U܉4$T$ezD>Mu
o;]tgG0D$ 4$ytt$ED$D$؉D$EЉ$xU|$4$T$zuMML4${${1L[^_]À|
oE$lgD$轂EtU$S|M$H|E܉$={U$2{4$*{fL[^_]ÍvED$D$D$UЉ$&xE${UD$D$T$MЉ$wEg11]ED$D$!D$MЉ$wD$\$U$6{Mte< taEUD$ $#xtML$E܉D$UD$$D$T$MЉ$,wM$zED$D$$3D$y|U܉$y4$yMD$:D$L$EЉ$vUD$D$T$MЉ$vE$v-U$JyMD$D$L$EЉ$hvU|$T$M$wuED$D$$3D${U$xM$yL1[^_]Ë]uo&EM܉$xGUD$ $vtM܉L$ED$D$D$UЉ$uM|$L$E܉$vuE$@yUD$D$$3T$zM܉$x4$
x
GM$fL$B4$wME$@gD$U܉$wM$w4$w$f~$f~M܉$pw$g~E܉$OwU$DwfUWVS<eE1D$$	{%D$b$Kx$x$8w<$@vtPpc9uc:Ftc9uc:Fuc:Ftt$D$cD$D$D$D$${>U$w$v$:w<$Bx><$0x$"v<$0utPpc9uc:Ftc9uc:Fuc:Ftt$D$cD$D$D$D$$yD$$5uUt$D$:D$$q<$ct3<$3w$u$T${$qv1҃tЋUe3uk<[^_]ÍT$${1͍D$$y{F$aT$^{$t<w$gT$.{b$E{LD$$gz$tА&UWVS,EUD$*$tE$ rvED$$D$qYEމ$wp$rE$s$oD$$`o\$E$oGUna$u$}r1,[^_]RD$E$mqXD$xE1$tBED$ $D$pEtI$qD$D$D$\$E$qu\$|$$ yD$=$oXD$ $Xtt\$$ۏxGD$UE$s,D$ZE$sD$_E$sD$dE$sD$iE$msD$nE$RsD$sE$7sD$xE$sED$ $D$ntyED$ $D$nt^D$;$NntJu
D$D$D$\$E$ou\$|$$}hwE$q$o,1[^_]D$(E$PrED$ $D$1nt$o;#t؋EtAD$D$D$\$E$"ou\$|$$v됉\$$ۏv{Et$$hD$vE$1p$)oD$eE$|qEt&ED$ $D$Qm$nEtAD$D$D$\$E$Cnu\$|$$u둃ED$D$$}tGD$ $qtt$$ۏu4$4n7\$$Phwu$nD$-E$jpD$2E$OpD$7E$4pD$<E$pD$AE$oD$FE$ogD$KE$oLD$PE$o1ED$ $D$k$lE2D$D$D$\$E$zlu\$|$$t$Ҏt$lE$m$gsE$mE$D$sE$hD$s$n$6lE$hD$ыED$E$hD$ZsE$D$Bs$(h1sTD$ZE$)nuD$_E$ntGD$;$~i3D$ $3nt\$$ۏr$D$:$7i\$$ۏrt&UWVS,EU$k1<$jtPpc9uc:Ftc9uc:Fuc:FtD$4$muD$e4$l4$kËE$kD$m5t$ED$cD$D$D$$nU$j<$i<$l1,[^_]D$-4$QlUD$<4$9l=D$A4$!l%D$24$	l
D$74$kD$F4$kD$K4$kD$P4$kD$U4$kD$Z4$yk}D$_4$akeD$d4$IkMD$i4$1k5D$n4$kD$s4$kD$x4$jD$+4$jD$!4$jD$(4$j"$ipo<$j,[^_]É\$$HiKo$g<$sj,[^_]ËE$hD$oUWVSÃ,U$i$kE11ɐW0f9uDD$$keJۉEEEEEG‰t]EL$$iD$*n4$f<$fEE,[^_]ËEEE9]vMtUE<$fE,[^_]%D$D$D$D$U$kE띃D$D$̋U{WIL@DCAR@D_IG@NOREf@}UZ1<$e$li;mE
UWVSLU$rkED$(E$c}4$fD$$cEU]؋]1UЉ]]9]r
E؀x!EEUiŰE\$$D$?fu$dD$)U؉$b-]؀;v@E9uZ:CuNzE؃9EEE{BOU@NDAR@Y_LE@FT}fb9ugUb:BuXE8~E؃9E~EE{LIN@E_MA@RKER@_LEFf@T}@A]؉$;e1E]1<|E9uEąEăT@E9E_E̍w{EXC@LUDI@NG_S@TRIN@G_AL@TERN@ATIVf@E:@E}܅ED$ߏUԉT$]؉$ig$h	}u|ÜEă9EU|$b<$b]܃E9]uE̍~}D$(U$`aMeE)$cỦ|$$D$c$cƋE9Ee$2b<$*bvE̍w{STR@ING_@ALTE@RNAT@IVE:@EUjE{BOU@NDAR@Y_RI@GHT}@EfE{LIN@E_MA@RKER@_RIG@HT}EE̍w{EXC@LUDI@NG_C@HAR_@ALTE@RNAT@IVE:@E@E$(jchE$aỦ$`EẼL[^_]ËE̍w{CHA@R_AL@TERN@ATIVf@E:@Eo$Ljg]$`Ẻ$`EẼL[^_]ËE{NOT@_BOU@NDAR@Y_RI@GHT}@E{NOT@_LIN@E_MA@RKER@_RIG@HT}hU$`U@E̋ẼL[^_]É$_U$_]̉$_EẼL[^_]ËE{NOT@_BOU@NDAR@Y_LE@FT}E{NOT@_LIN@E_MA@RKER@_LEFf@T}@$|jf_]$ŏ\$fut8EU_ŰE\$D$$5`}$^]$^]E8$ifE$|je$ie]$^$eẺ$n^U$c^Ei
UWVSÃL$_D${$\uD$[$[$cEU|11<[t<*t9vt<{u9uDM8}EEE}EE9EtNE$^]19t*ـ{z[q*[9u։yEȋu̅„<E9EẺD$E$jD$4dt&EUnE\$$D$[$\E9Et4]ątn$	c}EEEE9EE$]\$Rc1L[^_]ÄgE$kD$cOD$}<$ZED$-<$Y8D$D$<$aEtE$`~D$D$
D$$aZT$[uD$D$<$taEtE$`D$D$
D$$Y$[uD$D$<$
az$ZE$ZL[^_]EE$jD$b<$_tD$D$
D$<$RYxEȉED$$jaD$]<$>X7WEf$+Zv9D$*$X111<*9uM|E<$YEԃE9E[D$!E؉$D$_tdUtsEt$$D$W4$kYE9Es$	`$`E$>YE$0kD$y`$c`<$Y؍U't$E\$$D$2W$Xh$``&UWVSÁeE1 EVD$D$D$
$YD$4$[t5$k_4$YYEe3{[^_]ÍD$ D$D$D$!D$D$\$D$#FP$oTt$k_4$Xy4$]ED$`D$$7VFpuE7b@EED$$lUEAD$D$<$	\,D$|$$_[X]D$<$D$\2ED$ED$D$D$D$D$$~ZE1ҋ@u(v8 KL$T$D$$Y]]t C$bD$][u$z]B$EVUuE$V4$(W$k?]4$Wf$`k$]$t]v뤋E$U4$VuXKUWVSÁ<8[lD$;$KSD$D$DD$;$1X$D$h\;{1$D$A\$D$+\$%VD$D$D$D$$D$S@Z~1-$Ԑ[D$:$.R
$D$o[$8V[؋79;jt$$[a~;7|$$tlD$ZTD$$6Vm$T|}W$Zۉt<9]1<[^_]$
sZ1D$]$PXy$0ZD$:$P$D$D$D$:UÍ@$D$Y	$Wt>$YD$D$
D$$Pw$$l]Y$GY$D$1Y!:u":B!‹1\$X$X$Xr$Xa$XP$X?$őzX.$ܑiX$XX$GX$6X$%XD$=$Np\$$W11E$kW/$PD$W$kD$D$~W$PlmW$WW1$9W1$kW\$$>W{$(lVe$mVO'US$eE1$OD$$D$Mt<$Ot+uUe3u
$[]1>RUWVSÃ,D$E$pp$D$pEXD$$K$JKD$$K<$蘸ED$\$4$CQ\$$EtD$E4$D$4$yP4$M1,[^_]É$D$oEX't$$XmU4$M<$HP벉\$$艷4$	P4$M닉\$$Tq$,mT<$OS<$O4$2M9UWVSD$FeU1$nX"6K)D$D$D$
$\ND$4$PND$ D$D$D$!D$D$D$TD$#FP$I4$Q"FpO|D$`D$$JFpuE7b@EED$$JED$$=H&D$D$$PD$|$$OH]D$<$D$QwE̋HD$D$$D$R<<H]܉$D$\$D$ZN|D$D$\$$XKt[~itpt{D$$o)RẺ$J<$^M4$K1Ue3[^_]Ð$nQfu$hnQ$nQf$nQf$mQ4$rK$mQ4$WKi$miQ4$9KK$@nKQẺ$I<$L4$KM$:Q$mP\$$nP뫍vUWVSL $eU1(OKD$-$^HtJVDPu6$Po}P<$IUe3L [^_]D$/<$GtPEЉT$D${D$ D$D$ $M<$HUD$*$
JD$ $T$F
&D$ $T$F$HD$D$D$:$Jt/tEлD$$o"Oc1tc4$D$SMud4$GJEлD$$poN$lHJ1ۋ$WH5\$$oN։\$$o~N4$G뷍t&cJ$]ZNEлD$$=N&Uu}]D$$hpD$4$aItXD$4$BtnljD$$_$
It]u}]f]}u]D$014$Hu$pvM볍t&t$$[M똉'UWVSӁD$$gE@D$4$gXD$$Et
Et]ED$\$$B+Ef%=@1҉ƁČ[^_]ÐD$}4$-gD$@<$D$>AfËEtE$D<$#FČ[^_]D$4$f@Ev\u/zËEtaE1W$uD*]y1҉7$|pK\$$TpK]뚍t&'UWVS|@,UM1E]F,SUUT$D$$9AE%=uED$F,$l@Et6F,$=E|$D$E$ܒD$J<$JC^F,$ED$E|$$D$tJ1|[^_]$ԒtBF,$pD$FJ|[^_]ËED$D$$At<D$$ۏJ$B1닋F,$pD$Ik$pIUt&UWVSeE1xtD$<$DfDž~M$>D$$>xDxt$$>D$$ErD$<$>4$C~$D$U$CÍ$EC4$C4$,Au$xt7x|$$prD$\HUe3Ĝ[^_]É|$$r/HD$0<$CfDž~$qG띍D$t$$>~t$A$@9tPXc9uc:Ctc9uc:Cuc:Ctt$\$D$cD$D$D$D$D\$t$D$cD$D$D$$D\$$	4$A$Att$$qD$F4$A4$3?*T$$PrpF$A6D$4$;ui|$$r/F4$OA4$>t$$0r
F4$*A4$>$5A|$$E$r@uT$$PrEA$XqE6$Et$$qlE4$>x$qD$IEt&UWVSEUeE1B,&$F?*p$=ED$	$_@$?X$r=9$+:D$$9MD$	$-_|$@$&:$9D$$9%Ut$B,$9MUA, 蔵\$D$+D$ D$D$ D$EЉ$yAM5<$>4$><$S<4$K<t)UD$	$6^1ɋPE1҃tbfMe3
gĜ[^_]ÍvMA,$sD$8C<$X>4$P><$;4$;롐MЍ]L$D$8D$ D$D$ $@EЉ\$$:t>UЉ$<$tB:FD$$0sB\$$4t}B|$$scB<$;ED$	$\@$sD$+B<$K=<$:t$$sB4$:=$rAlMA,$sD$AJUD$	$W\@$sD$A$Ts~A$shA8vU$RNA	x$dtD$9A$t-A$t!A$tA$4u	A$u@$u@$v@$hv@$v@$w@$Tw@$w@$w@$,x@$|x@$xy@$ym@$Xya@$yU@$yI@$(z=@$|z1@$z%@<${D$@$L{@${?${?$H|?$|?$|?$@}?$}?$}?$(~?$p~?$~?$t?$dh?$\?$P?$HD?$8?$؀,?$$ ?$x?$?$>$T>$>$>$4>$>$R>fL$qUWVSQ1eE1Yx?4$s3HD$D$D$ D$\$t$$IcLD$L$X@pD$L$XxAD$L$sXp<D$L$RXXt=$1}zL$XUe3Y[^_]aD$jL$WHD$-L˚$WPu@t&\$<$|3$ƍD$t$34$5D$ |$$4t1L$W5ff8fL1$`W$?<$.<4$4lD$6L$V@t1ҋL}0D$:L$zV@t)‰$7$̃D$;D$?L$4V@zD$vL$V@QD$RL$U@D$RL$UD$@$0D$D$$9D$D$D$c$
5$S84$15f$96D$aL$$U@D$aL$UXD$$X/Pc$14$5\$D$PD$D$$X7D$D$A4$.TD$D$P$1D$$1t$3\$<$D$~0$
2D$nL$SxDžD$L$Spu!D$L$SXD$L$SDžHtD$L$mS@D$D$Y$.D$nL	$"SL D@D	(3/D$`D$\$$c-d$"4$D$7$1-D$RL$rR@$8D$7D$L$DR@~D$L$#R@]D$/L$RxD$/L$QX$^1\$$7D$-$-:$D$6F$ĔD$6F$єD$6F$D$6F$D$6D$/L$+QXD$!$1t&F$D$Q6F$D$>64$^/D$u$>1$$016[LPC4$1.P$#1<$1\$$X5$B5$j/*m11vT$L,D$D$jD$ D$D$ $2ĕt,D$$-u,$kx$4t$$Ȅ4$R-P$/<$/4$.4$'-t$$j44$-P$/$|f:4P$t/w4$B-e\$f$4L1DžTDžLD$\$T$$X3D$tL$bNPtqt9sc)9w]$3@1ۋT$,;u$N3DžTDžLB,;D$!$/.u#D$+LA,$.vD$LA,D$$)ƅ$,XXAY$+$D$u29DžClamDžAV-VDžDB:$-$k(D$$,\$]̉$D$ÓD$ 0\$D$$*$+D$D$D$T$$/$+D$D$D$T$$.D$L$KÍ$D+SD$D$D$T$$t.$+dD$D$Փ$)$ړ'kUD$ D$$'EE$D$D$($*D$D$D$T$$-LL$D${D$ D$D$ $-D$$(u$*D$$)lD$D$ۏD$l$j%e1]DžhhhfލL/$\$T$D$jD$ D$D$ ,tD$$'y2D$T$D$D$D$l$Z$$'fD$D$TD$D$D$l$
$z$&;t?TwuL$$-l$'JD$L$rH@l˺$#$?$uD$\$4$d&lD$ D$$T$R+uč\$4$)D$L$GٍU@D$$ xD$D$D$l$"$%l$r&dƄ$c("D$!$"D$YD$$!!1uL,T$$D$D$jD$ D$D$ ),D$$$u,T$\$$<u$C"4$%4$S$t1ۋT$3$;u䋅T$$$_+l$$$#$ =+T$#uL$$p+l$$$ *t1ۋT$}#9w뎍L$$L*벍L$$*l$7$A$~*l$$j$ t1ۋT$"9w䋍T$"D$*4$5$\jD$D$\$!\$$#D$pD$D$T$$&$,"D$L$D@dD$L$CU@D$$É6$#\$D$pD$D$$J&$|!ML$D$$ $"D$D$D$T$$%$p"=hD$D$$w D$&\$$蕇1T\$$D$_V;uω$[ut$$x'4$^ kT$< ;uJ$D{'01ۋT$;u
$>'$4$V!4$1ۋT$;uD$nL$AxD$b<$ ``D$D$$T$!=uZ\D$ D$$T$_$`\$D$$L$!9t|$$4%&\$4$7 4$`$<$ 7$ %\$u4t$$%\$Rt$$̈%$14$4$T$
;u$
$4$`4$1ۋT$;u$fX:@\$t`$f4$ts4$Q|$$h$D$L$3?@XtD$L$?@tE$t1C$t$$O.$4$N4$<$9\$x5D$$*tY$D$#$]<$|$$X#\$2$D$%zD$D$$,ƅ$$D$$Mtb$D$"$$<$
$"<$<$D$ELMT$$D$D$+D$ D$D$ M衣Ë$I$s1ҍE:$MD$L$$r|Mx$ D$0$.cdif@ff@ED$-$D$BD$.$|D$b4$3jxT$D$D$$D$$}MD$*$pD$˚4$UpD$ D$<$D$jD$|$$"u‰t$$<F 4$f4$p$$f$ $<$:L$$؉$p$[$3D$*4$$?tI\$D$ D$<$SthD$|$t$)ȉt$$/4$O4$p$WED$$؊[$\$t$7D$L$i9ٍU@D$$ 荒D$b4$|$D$D$$5<$$t$$h=4$1~4$N4$$\t$$`ct$$ԋN$=t$$$a4$Tt$$4$2$\y4$$ [4$ED$$1|MlL$D$8D$ D$D$ $E\$$0tmU$$t|$$؉$$?$<$\$$4tb$\L$6D$L$6ptH1ҋLJ$:tF$	$'D$D$L$f6Xt$C1D$L$/6HZ$cDžTDž$tttxD$x<$+t׋D$T$T<$@T뀋$Tt(D$D$D$T$D$$a\u,$,A$+vCD$T$À=aTuD$$t/$aP891ۋ$<;u4$'$s$	:tlast@.hdb@o$f8DžTDž]D$L$3PLA,kD$L$3D$*@$D$LA,$
t$D$<$t)<$tډwuDžH$4$Hu1ۋ$;ut$:D$L$2@$|D$4$\D$Lf$E2@$|D$$TlD$L$2@uD$L$1@tLeD$	L$1@L,D$L$v1Xu"T$$$D$L$71PPD$L1ۉ$1@$ID$$MD$ D$$E$IyP҉uLT$$D$D$D$D$D$CD$$}tLuLT$D$D$&D$D$D$$D$$tXuLL$D$pD$D$D$D$$k$]
$l$>$6
$ )؉D$$k$z1XD$$b
$-T$;uD$$D$L$}.@LA,0D$L$C.ً@wD$uLB,$wg$ȆK1ۋT$;u$,	T$>D$FL$-xtLF	D$L$S-ptLaD$	L$-Xt|LQ,TD$$D$bd%=@tCLB,$D$	,1ɉڋ@8;,LA,$D$	q,1҉ً@LB,$D$$̌rU]Ít&'UWVS^1E)E}Ut+1ƍED$ED$E$9}u߃[^_]Ë$ÐUStЋu[]US[ØY[ERROR: %sWARNING: %sLog size = %zu, max = %zu
-%Y%m%d_%H%M%S%s -> LOG_AUTHLOG_AUTHPRIVLOG_CRONLOG_DAEMONLOG_FTPLOG_KERNLOG_LPRLOG_MAILLOG_NEWSLOG_SYSLOGLOG_USERLOG_UUCPLOG_LOCAL0LOG_LOCAL1LOG_LOCAL2LOG_LOCAL3LOG_LOCAL4LOG_LOCAL5LOG_LOCAL6LOG_LOCAL7WARNING: Log size limit met but log file rotation turned off. Forcing log file rotation anyways.
Need to rotate log file due to size but ran out of memory.
Need to rotate log file due to size but could not get local time.
ERROR: Can't open %s in append mode (check permissions!).
WARNING: File locking not supported (NFS?)ERROR: %s is locked by another process
 PHXŖΖ0֖ߖ8 (@&1<GRPOSIXLY_CORRECT%s: illegal option -- %c
%s: unrecognized option `%s'
%s: option `%s' is ambiguous
%s: option requires an argument -- %c
%s: option `--%s' doesn't allow an argument
%s: option `--%s' requires an argument
ERROR: optaddarg: Unregistered option %s
ERROR: optaddarg: strdup() failed
ERROR: optaddarg: malloc() failed
ERROR: optparse: Can't register new option (not enough memory)
ERROR: Problem parsing options (name == NULL)
ERROR: Parse error at line %d: Unknown option %s
WARNING: Ignoring unsupported option %s at line %u
ERROR: Can't register argument for option %s
WARNING: Ignoring deprecated option %s at line %u
ERROR: optparse: Can't compile regular expression %s for option %s
ERROR: Incorrect argument format for option %s
ERROR: Can't parse numerical argument for option %s
ERROR: Can't register argument for option --%s
WARNING: Numerical value for option %s too high, resetting to 4G
ERROR: optparse: longopts[] is too small
ERROR: optparse: shortopts[] is too small
ERROR: optparse: (short|long)opts[] is too small
ERROR: Please edit the example config file %s
ERROR: Missing argument for option at line %d
ERROR: Missing closing parenthesis in option %s at line %d
ERROR: Empty argument for option %s at line %d
ERROR: Incomplete option passed (missing argument)
ERROR: optparse: No corresponding long name for option '-%c'
WARNING: Ignoring unsupported option --%s (-%c)
WARNING: Ignoring unsupported option --%s
WARNING: Ignoring deprecated option --%s (-%c)
WARNING: Ignoring deprecated option --%s
ERROR: Incorrect argument format for option --%s (-%c)
ERROR: Incorrect argument format for option --%s
ERROR: Option --%s (-%c) requires a non-empty string argument
ERROR: Option --%s requires a non-empty string argument
ERROR: Can't parse numerical argument for option --%s (-%c)
ERROR: Can't parse numerical argument for option --%s
WARNING: Numerical value for option --%s (-%c) too high, resetting to 4G
ERROR: optparse: calloc failed
ERROR: optparse: strdup failed
Dump authenticode certificate chain.Always generate MDB entries for PE sectionsMaximum number of mismatched signatures when building a CVD. Zero disables this limit.Feature level to put in the CVDVersion number of the CVD to buildForce using the interpreter instead of the JITTrust loaded bytecode (default yes)Load and print bytecode information without executingInput file to run the bytecode nDon't show source line during tracingSave all reports to a log file.HostID in the form of an UUID to use when submitting statistical information. See the clamscan manpage for more information.Enable submission of statistical dataDisable submission of PE section statistical dataTimeout in seconds to timeout communication with the stats server.By default the log file is locked for writing and only a single
daemon process can write to it. This option disables the lock.Maximum size of the log file.
Value of 0 disables the limit.Log all clean files.
Useful in debugging but drastically increases the log size.Use the system logger (can work together with LogFile).Type of syslog messages.
Please refer to 'man syslog' for the facility names.Rotate log file. Requires LogFileMaxSize option set prior to this option.Log additional information about the infected file, such as its
size and hash, together with the virus name.Save the process ID to a file.This option allows you to change the default temporary directory.This option allows you to change the default database directory.
If you enable it, please make sure it points to the same directory in
both clamd and freshclam.Only load the official signatures published by the ClamAV project.Path to a local socket file the daemon will listen on.Sets the group ownership on the unix socket.Sets the permissions on the unix socket to the specified mode.Remove a stale socket after unclean shutdownA TCP port number the daemon will listen on.By default clamd binds to INADDR_ANY.
This option allows you to restrict the TCP address and provide
some degree of protection from the outside world.Maximum length the queue of pending connections may grow to.Close the STREAM session when the data size limit is exceeded.
The value should match your MTA's limit for the maximum attachment size.The STREAM command uses an FTP-like protocol.
This option sets the lower boundary for the port range.This option sets the upper boundary for the port range.Maximum number of threads running at the same time.This option specifies the time (in seconds) after which clamd should
timeout if a client doesn't provide any data.This option specifies the time (in seconds) after which clamd should
timeout if a client doesn't provide any initial command after connecting.This option specifies how long to wait (in miliseconds) if the send buffer
is full. Keep this value low to prevent clamd hanging.Waiting for data from clamd will timeout after this time (seconds).Maximum number of queued items (including those being processed by MaxThreads
threads). It is recommended to have this value at least twice MaxThreads
if possible.
WARNING: you shouldn't increase this too much to avoid running out of file
 descriptors, the following condition should hold:
 MaxThreads*MaxRecursion + MaxQueue - MaxThreads  + 6 < RLIMIT_NOFILE
 (usual max for RLIMIT_NOFILE is 1024)
This option specifies how long (in seconds) the process should wait
for a new job.Don't scan files/directories whose names match the provided
regular expression. This option can be specified multiple times.Maximum depth the directories are scanned at.Follow symlinks to regular files.Scan files and directories on other filesystems.This option specifies the time intervals (in seconds) in which clamd
should perform a database check.This option allows you to disable clamd's caching feature.Execute a command when a virus is found. In the command string %v will be
replaced with the virus name. Additionally, two environment variables will
be defined: $CLAM_VIRUSEVENT_FILENAME and $CLAM_VIRUSEVENT_VIRUSNAME./usr/bin/mailx -s "ClamAV VIRUS ALERT: %v" alert < /dev/nullStop the daemon when libclamav reports an out of memory condition.Permit use of the ALLMATCHSCAN command.Enable debug messages in libclamav.Don't remove temporary files (for debugging purposes).Run the daemon as a specified user (the process must be started by root).Initialize a supplementary group access (the process must be started by root).With this option enabled ClamAV will load bytecode from the database. It is highly recommended you keep this option on, otherwise you'll miss detections for many new viruses.Set bytecode security level.
Possible values:
	TrustSigned - trust bytecode loaded from signed .c[lv]d files,
		 insert runtime safety checks for bytecode loaded from other sources
	Paranoid - don't trust any bytecode, insert runtime checks for all
Recommended: TrustSigned, because bytecode in .cvd files already has these checks.Set bytecode timeout in miliseconds.Allow loading bytecode from outside digitally signed .c[lv]d files.^(Auto|ForceJIT|ForceInterpreter|Test)$Set bytecode execution mode.
Possible values:
	Auto - automatically choose JIT if possible, fallback to interpreter
ForceJIT - always choose JIT, fail if not possible
ForceIntepreter - always choose interpreter
Test - run with both JIT and interpreter and compare results. Make all failures fatal.Collect and print bytecode execution statistics.Detect Potentially Unwanted Applications.Exclude a specific PUA category. This directive can be used multiple times.
See http://www.clamav.net/support/pua for the complete list of PUA
categories.Only include a specific PUA category. This directive can be used multiple
times.In some cases (eg. complex malware, exploits in graphic files, and others),
ClamAV uses special algorithms to provide accurate detection. This option
controls the algorithmic detection.PE stands for Portable Executable - it's an executable file format used
in all 32- and 64-bit versions of Windows operating systems. This option
allows ClamAV to perform a deeper analysis of executable files and it's also
required for decompression of popular executable packers such as UPX or FSG.
If you turn off this option, the original files will still be scanned, but
without additional processing.Executable and Linking Format is a standard format for UN*X executables.
This option allows you to control the scanning of ELF files.
If you turn off this option, the original files will still be scanned, but
without additional processing.With this option enabled clamav will try to detect broken executables
(both PE and ELF) and mark them as Broken.Executable.Enable the built in email scanner.
If you turn off this option, the original files will still be scanned, but
without parsing individual messages/attachments.Scan RFC1341 messages split over many emails. You will need to
periodically clean up $TemporaryDirectory/clamav-partial directory.
WARNING: This option may open your system to a DoS attack. Please don't use
this feature on highly loaded servers.With this option enabled ClamAV will try to detect phishing attempts by using
signatures.Scan URLs found in mails for phishing attempts using heuristics.Always block cloaked URLs, even if they're not in the database.
This feature can lead to false positives.PhishingAlwaysBlockSSLMismatchAlways block SSL mismatches in URLs, even if they're not in the database.
This feature can lead to false positives.Detect partition intersections in raw disk images using heuristics.Allow heuristic match to take precedence.
When enabled, if a heuristic scan (such as phishingScan) detects
a possible virus/phish it will stop scan immediately. Recommended, saves CPU
scan-time.
When disabled, virus/phish detected by heuristic scans will be reported only
at the end of a scan. If an archive contains both a heuristically detected
virus/phish, and a real malware, the real malware will be reported.
Keep this disabled if you intend to handle "*.Heuristics.*" viruses
differently from "real" malware.
If a non-heuristically-detected virus (signature-based) is found first,
the scan is interrupted immediately, regardless of this config option.Enable the Data Loss Prevention module.This option sets the lowest number of Credit Card numbers found in a file
to generate a detect.This option sets the lowest number of Social Security Numbers found
in a file to generate a detect.With this option enabled the DLP module will search for valid
SSNs formatted as xxx-yy-zzzz.With this option enabled the DLP module will search for valid
SSNs formatted as xxxyyzzzzPerform HTML/JavaScript/ScriptEncoder normalisation and decryption.
If you turn off this option, the original files will still be scanned, but
without additional processing.This option enables scanning of OLE2 files, such as Microsoft Office
documents and .msi files.
If you turn off this option, the original files will still be scanned, but
without additional processing.With this option enabled OLE2 files with VBA macros, which were not
detected by signatures will be marked as "Heuristics.OLE2.ContainsMacros".This option enables scanning within PDF files.
If you turn off this option, the original files will still be scanned, but
without decoding and additional processing.This option enables scanning within SWF files.
If you turn off this option, the original files will still be scanned, but
without decoding and additional processing.Scan within archives and compressed files.
If you turn off this option, the original files will still be scanned, but
without unpacking and additional processing.Mark encrypted archives as viruses (Encrypted.Zip, Encrypted.RAR).This option causes memory or nested map scans to dump the content to disk.
If you turn on this option, more data is written to disk and is available
when the leave-temps option is enabled at the cost of more disk writes.This option sets the maximum amount of data to be scanned for each input file.
Archives and other containers are recursively extracted and scanned up to this
value.
The value of 0 disables the limit.
WARNING: disabling this limit or setting it too high may result in severe
damage.Files/messages larger than this limit won't be scanned. Affects the input
file itself as well as files contained inside it (when the input file is
an archive, a document or some other kind of container).
The value of 0 disables the limit.
WARNING: disabling this limit or setting it too high may result in severe
damage to the system.Nested archives are scanned recursively, e.g. if a Zip archive contains a RAR
file, all files within it will also be scanned. This option specifies how
deeply the process should be continued.
The value of 0 disables the limit.
WARNING: disabling this limit or setting it too high may result in severe
damage to the system.Number of files to be scanned within an archive, a document, or any other
container file.
The value of 0 disables the limit.
WARNING: disabling this limit or setting it too high may result in severe
damage to the system.This option sets the maximum size of a file to check for embedded PE.
Files larger than this value will skip the additional analysis step.
Negative values are not allowed.
WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a HTML file to normalize.
HTML files larger than this value will not be normalized or scanned.
Negative values are not allowed.
WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a normalized HTML file to scan.
HTML files larger than this value after normalization will not be scanned.
Negative values are not allowed.
WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a script file to normalize.
Script content larger than this value will not be normalized or scanned.
Negative values are not allowed.
WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a ZIP file to reanalyze type recognition.
ZIP files larger than this value will skip the step to potentially reanalyze as PE.
Negative values are not allowed.
WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of partitions of a raw disk image to be scanned.
Raw disk images with more partitions than this value will have up to the value number partitions scanned.
Negative values are not allowed.
WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of icons within a PE to be scanned.
PE files with more icons than this value will have up to the value number icons scanned.
Negative values are not allowed.
WARNING: setting this limit too high may result in severe damage or impact performance.This option enables on-access scanning (Linux only)This option specifies a directory (including all files and directories
inside it), which should be scanned on access. This option can
be used multiple times.This option allows excluding directories from on-access scanning. It can
be used multiple times.With this option you can whitelist specific UIDs. Processes with these UIDs
will be able to access all files.
This option can be used multiple times (one per line).Files larger than this value will not be scanned in on access.When started by root freshclam will drop privileges and switch to the user
defined in this option.This option defined how many times daily freshclam should check for
a database update.Use DNS to verify the virus database version. Freshclam uses DNS TXT records
to verify the versions of the database and software itself. With this
directive you can change the database verification domain.
WARNING: Please don't change it unless you're configuring freshclam to use
your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect.
You should have at least two entries: db.XY.clamav.net (or db.XY.ipv6.clamav.net
for IPv6) and database.clamav.net (in this order). Please replace XY with your
country code (see http://www.iana.org/cctld/cctld-whois.htm).
database.clamav.net is a round-robin record which points to our most reliable
mirrors. It's used as a fall back in case db.XY.clamav.net is not working.db.XY.clamav.net
database.clamav.netThis option allows you to easily point freshclam to private mirrors.
If PrivateMirror is set, freshclam does not attempt to use DNS
to determine whether its databases are out-of-date, instead it will
use the If-Modified-Since request or directly check the headers of the
remote database files. For each database, freshclam first attempts
to download the CLD file. If that fails, it tries to download the
CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo
and Scripted Updates. It can be used multiple times to provide
fall-back mirrors.mirror1.mynetwork.com
mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new
databases into memory to make sure they are properly handled
by libclamav before replacing the old ones.By default freshclam will keep the local databases (.cld) uncompressed to
make their handling faster. With this option you can enable the compression.
The change will take effect with the next database update.Download an additional 3rd party signature database distributed through
the ClamAV mirrors. This option can be used multiple times.
Here you can find a list of available databases:
http://www.clamav.net/download/cvd/3rdpartyWith this option you can provide custom sources (http:// or file://) for database files.
This option can be used multiple times.http://myserver.com/mysigs.ndb
file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent
filtering you can use this option to force the use of a different
User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version.
In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downlading.
Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server.When enabled freshclam will submit statistics to the ClamAV Project about
the latest virus detections in your environment. The ClamAV maintainers
will then use this data to determine what types of malware are the most
detected in the field and in what geographic area they are.
Freshclam will connect to clamd in order to get recent statistics.Country of origin of malware/detection statistics (for statistical
purposes only). The statistics collector at ClamAV.net will look up
your IP address to determine the geographical origin of the malware
reported by your installation. If this installation is mainly used to
scan data which comes from a different location, please enable this
option and enter a two-letter code (see http://www.iana.org/domains/root/db/)
of the country of origin.This option enables support for our "Personal Statistics" service.
When this option is enabled, the information on malware detected by
your clamd installation is made available to you through our website.
To get your HostID, log on http://www.stats.clamav.net and add a new
host to your host list. Once you have the HostID, uncomment this option
and paste the HostID here. As soon as your freshclam starts submitting
information to our stats collecting service, you will be able to view
the statistics of this clamd installation by logging into
http://www.stats.clamav.net with the same credentials you used to
generate the HostID. For more information refer to:
http://www.clamav.net/support/faq/faq-cctts/
This feature requires SubmitDetectionStats to be enabled.This option enables support for Google Safe Browsing. When activated for
the first time, freshclam will download a new database file (safebrowsing.cvd)
which will be automatically loaded by clamd and clamscan during the next
reload, provided that the heuristic phishing detection is turned on. This
database includes information about websites that may be phishing sites or
possible sources of malware. When using this option, it's mandatory to run
freshclam at least every 30 minutes.
Freshclam uses the ClamAV's mirror infrastructure to distribute the
database and its updates but all the contents are provided under Google's
terms of use. See http://www.google.com/transparencyreport/safebrowsing
and https://github.com/vrtadmin/clamav-faq/blob/master/faq/faq-safebrowsing.md for more information.This option enables downloading of bytecode.cvd, which includes additional
detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Define the clamd socket to connect to for scanning.
This option is mandatory! Syntax:
  ClamdSocket unix:path
  ClamdSocket tcp:host:port
The first syntax specifies a local unix socket (needs an absolute path) e.g.:
  ClamdSocket unix:/var/run/clamd/clamd.socket
The second syntax specifies a tcp local or remote tcp socket: the
host can be a hostname or an ip address; the ":port" field is only required
for IPv6 addresses, otherwise it defaults to 3310
  ClamdSocket tcp:192.168.0.1
This option can be repeated several times with different sockets or even
with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail.
This option is mandatory! Possible formats are:
[[unix|local]:]/path/to/file - to specify a unix domain socket;
inet:port@[hostname|ip-address] - to specify an ipv4 socket;
inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.socket
inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned
This option takes a host(name)/mask pair in CIRD notation and can be
repeated several times. If "/mask" is omitted, a host is assumed.
To specify a locally orignated, non-smtp, email use the keyword "local".local
192.168.0.0/24
1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing).
The following actions are available:
Accept: the message is accepted for delievery
Reject: immediately refuse delievery (a 5xx error is returned to the peer)
Defer: return a temporary failure message (4xx) to the peer
Blackhole: like Accept but the message is sent to oblivion
Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to
allocate data structures, no scanners available, network timeouts, unknown
scanner replies and the like.
The following actions are available:
Accept: the message is accepted for delievery;
Reject: immediately refuse delievery (a 5xx error is returned to the peer);
Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages
and it's therefore only useful together with "OnInfected Reject"
The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an
"X-Virus-Status" headers will be attached to each processed message, possibly
replacing existing headers.
If it is set to Add, the X-Virus headers are added possibly on top of the
existing ones.
Note that while "Replace" can potentially break DKIM signatures, "Add" may
confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported
hostname. This may be desirable in order to avoid leaking internal names.
If unset the real machine name is used.Execute a command when an infected message is processed.
The following parameters are passed to the invoked program in this order:
virus name, queue id, sender, destination, subject, message id, message date.
Note #1: this requires MTA macroes to be available (see LogInfected below)
Note #2: the process is invoked in the context of clamav-milter
Note #3: clamav-milter will wait for the process to exit. Be quick or fork to
avoid unnecessary delays in email delievery/usr/local/bin/my_infected_message_handlerChroot to the specified directory.
Chrooting is performed just after reading the config file and before
dropping privileges.This option specifies a file which contains a list of basic POSIX regular
expressions. Addresses (sent to or from - see below) matching these regexes
will not be scanned.  Optionally each line can start with the string "From:"
or "To:" (note: no whitespace after the colon) indicating if it is,
respectively, the sender or recipient that is to be whitelisted.
If the field is missing, "To:" is assumed.
Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX
regular expression (egrep-like) will not be scanned.
As an alternative, a file containing a plain (not regex) list of names (one
per line) can be specified using the prefix "file:".
e.g. SkipAuthenticated file:/etc/good_guys

Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected.
Possible values are Off (the default - nothing is logged),
Basic (minimal info logged), Full (verbose info logged)
Note:
For this to work properly in sendmail, make sure the msg_id, mail_addr,
rcpt_addr and i macroes are available in eom. In other words add a line like:
Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i
to your .cf file. Alternatively use the macro:
define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i')
Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message.
See LogInfected for possible values and caveats.
Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction
when a message with multiple recipients is scanned:
If SupportMultipleRecipients is off (the default)
then one single log entry is generated for the message and, in case the
message is determined to be malicious, the command indicated by VirusAction
is executed just once. In both cases only the last recipient is reported.
If SupportMultipleRecipients is on:
then one line is logged for each recipient and the command indicated
by VirusAction is also executed once for each recipient.

Note: although it's probably a good idea to enable this option, the default value
is currently set to off for legacy reasons.fooyestrueExample 	ERROR: Unknown option passed
help^(yes|true|1|no|false|0)$config-file/etc/clamd.conf/etc/freshclam.conf/etc/clamav-milter.confdebugdumpcertsquietleave-tempsno-warningsstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/var/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedsuppress-ok-resultscopyremoveexcludeexclude-dirincludeinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256print-certshtml-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentlist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffdefaultcolorsconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KM]?$block-maxunzipunrararjunzoolhajartartgzdeb/tmp/clamav.logstats-host-idStatsEnabledenable-statsStatsPEDisableddisable-pe-statsnoStatsTimeoutstats-timeoutLogFileUnlockLogFileMaxSizeLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/var/run/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadir/var/lib/clamavOfficialDatabaseOnlyofficial-db-onlyLocalSocket/tmp/clamd.socketLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketTCPSocket3310TCPAddr127.0.0.1MaxConnectionQueueLength30StreamMaxLength25MStreamMinPort1024StreamMaxPort2048MaxThreads120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/
^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600DisableCachedisable-cacheVirusEventExitOnOOMAllowAllMatchScanForegroundDon't fork into background.DebugLeaveTemporaryFilesUserAllowSupplementaryGroupsBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout5000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoBytecodeStatisticsbytecode-statisticsDetectPUAdetect-puaExcludePUAexclude-puaNetTool
PWToolIncludePUAinclude-puaSpy
Scanner
RATAlgorithmicDetectionalgorithmic-detectionScanPEscan-peScanELFscan-elfDetectBrokenExecutablesdetect-brokenScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsPhishingAlwaysBlockCloakphishing-cloakphishing-sslPartitionIntersectionpartition-intersectionHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2OLE2BlockMacrosScanPDFscan-pdfScanSWFscan-swfScanArchivescan-archiveArchiveBlockEncryptedblock-encryptedForceToDiskforce-to-diskmax-scansize100Mmax-filesizemax-recursion16max-files10000MaxEmbeddedPEmax-embeddedpe10MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags2MMaxScriptNormalizemax-scriptnormalizeMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100OnAccessIncludePath/home
/studentsOnAccessExcludePath/home/bofh
/rootOnAccessExcludeUIDOnAccessMaxFileSizeDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrorPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1
dbname2DatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutSubmitDetectionStats/path/to/clamd.confDetectionStatsCountrycountry-codeDetectionStatsHostIDunique-idSafeBrowsingDisableCertChecknocertsMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsClamukoScanOnAccessClamukoScannerCountClamukoScanOnOpenClamukoScanOnCloseClamukoScanOnExecClamukoIncludePathClamukoExcludePathClamukoExcludeUIDClamukoMaxFileSizeClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootWhitelist/etc/whitelisted_addressesSkipAuthenticatedLogInfectedBasicSupportMultipleRecipientsjhoKKcKKKKcKKVoKKo+KK	vo:KKoKo:KKoKKoKKo:KKdoKK
oKKoKK!KK+oKK2moKK<oKKCoKKJzoKKSd\KKhroKKroKzKKKKoKKoKKfKKioKKooKKKKKKoKKKKKKKKKKKK-o KK6o KK:o KK?o KKvo KKF KKR KKa KKnb KKt M hK Ko KKo KK KKu KK KK/i KKl\ KKf\ KKo KK KK KK KK	d KKc KKr KK	 KK	doKK"	c-	@KK2	no@KK>	g@KKN	foK`	toܢK/ioKo	pox	K	r8K	t	K	so\K	aoKK	toKK	KK	KK
KK
oKK
oKK&
oKK6
oKKA
oKKG
oKKN
oKKV
oKK]
oKKe
oKKm
oKK~
oKK
oKK
oKK
KK

KK
oKK
4KK
4KK
4KK
4KK4KK4KK4KK4KK4KK6l$6	2?o$8L\o	Lmp},
oĤ8
Dn
o8o8oإ8G֖o8o`8#o89OpASf-<ns\#o	$mhШ


o8 
@*
/
p7
A
Z
]

Hm
q
Ъ

8


p

x




x,

dp


T


	ԯo7mRomevo	(8X\o	İmܱo8o`8omomomo0m.	o	87Ha0am}	|o	m	o<mo	p8	)8C	8O_to	8o	H8o	8o	л8o	L8omp
o	8

o	@84o	mCo	KPfo	8}o	ȿ8o	\m	
 	5oH8Oomkto	8~o	8omo	8o	8o	`8o	mo	Hm
@	()4.

Dm
;	I*L'	V\j
	y}
	y
 	
P	n

	2	$(3d	 ?o<mCpWg{tZ
Pn
o	KK	KKo	KK
oKK6l#:	u\HOc
Vff}X@ho8oH8oK,
h%3EJ\e>w6	8Da,<8Z
KpZ
Zoo8.o8o	pmKKKKKK#KK3KKNoKK^oKKvo	KKoKKKKoKKoKKoKKKKKKKK-
PKK@Lf4`s

HxHx$
m!)8LX_h@rLto8oKKsKKoKKoKKoKKKKvoKK
KK*KKKKoKKoKKkoKKoKK~oKKoKK]

KK/
KK 
KKSKK0.98.4%s//dev/nullCan't open /dev/null
dup2(%d, %d) failed
%s/daily.cvd%s/daily.cldClamAV %s
ClamAV %s/%u/%sERROR: This tool requires libclamav with functionality level %u or higher (current f-level: %u)
ERROR: --file-list: Can't open file %s
!cdiff_apply: Problem parsing line
!cdiff_apply: Unknown command %s
!cdiff_apply: Not enough arguments for %s
!cdiff_apply: Can't execute command %s
!cdiff_cmd_unlink: Database %s is still open
!cdiff_cmd_unlink: Can't get first argument
!cdiff_cmd_unlink: Forbidden characters found in database name
!cdiff_cmd_unlink: Can't unlink %s
!cdiff_cmd_add: Can't get first argument
!cdiff_cmd_add: Can't allocate memory for cdiff_node
!cdiff_cmd_open: Can't get first argument
!cdiff_cmd_open: %s not closed before opening %s
!cdiff_cmd_open: Forbidden characters found in database name
!cdiff_apply: Can't duplicate descriptor %d
!cdiff_apply: Can't allocate memory for 'line'
!cdiff_apply: Can't allocate memory for 'lbuf'
!cdiff_apply: lseek(desc, %d, SEEK_END) failed
!cdiff_apply: Can't read %d bytes
!cdiff_apply: No digital signature in cdiff file
!cdiff_apply: Can't fstat file
!cdiff_apply: compressed data end offset < 0
!cdiff_apply: lseek(desc, 0, SEEK_SET) failed
14783905874077467090262228516557917570254599638376203532031989214105552847269687489771975792123442185817287694951949800908791527542017115600501303394778618535864845235700041590056318230102449612217458549016089313306591388590790796515819654102320725712300822356348724011232654837503241736177907784198700834440681124727060540035754699658105895050096576226753008596881698828185652424901921668758326578462003247906470982092298106789657211905488986281078346361469524484829559560886227198091995498440676639639830463593211386055065360288422394053998134458623712540683294034953818412458362198117811990006021989844180721010947!cdiff_apply: Incorrect digital signature
!cdiff_apply: Incorrect file format
!cdiff_apply: Can't gzdopen descriptor %d
!cdiff_apply: Premature EOF at line %d
^cdiff_apply: Ignoring new buffer size request - invalid size %d
!cdiff_apply: Can't resize line buffer to %d bytes
!cdiff_apply: Error executing command at line %d
!cdiff_apply: fdopen() failed for descriptor %d
*cdiff_apply: File %s was not properly closed
*cdiff_apply: Parsed %d lines and executed %d commands
!cdiff_cmd_del: Can't get first argument
!cdiff_cmd_del: Can't get second argument
!cdiff_cmd_del: Can't allocate memory for cdiff_node
!cdiff_cmd_xchg: Can't get first argument
!cdiff_cmd_xchg: Can't get second argument
!cdiff_cmd_xchg: Can't allocate memory for cdiff_node
!cdiff_cmd_close: No database to close
!cdiff_cmd_close: Can't open file %s for reading
!cdiff_cmd_close: Can't generate temporary name
!cdiff_cmd_close: Can't open file %s for writing
!cdiff_cmd_close: Can't apply DEL at line %d of %s
!cdiff_cmd_close: Can't apply XCHG at line %d of %s
!cdiff_cmd_close: Can't write to %s
!cdiff_cmd_close: Not all DEL/XCHG have been executed
!cdiff_cmd_close: Can't unlink %s
!cdiff_cmd_close: Can't rename %s to %s
!cdiff_cmd_close: Can't open file %s for appending
!cdiff_cmd_move: Database %s is still open
!cdiff_cmd_move: Can't get third argument
!cdiff_cmd_move: Can't get fifth argument
!cdiff_cmd_move: end_line < start_line
!cdiff_cmd_move: Can't get fourth argument
!cdiff_cmd_move: Can't get sixth argument
!cdiff_cmd_move: Can't get first argument
!cdiff_cmd_move: Can't open %s for reading
!cdiff_cmd_move: Can't get second argument
!cdiff_cmd_move: Can't open %s for appending
!cdiff_cmd_move: Can't generate temporary name
!cdiff_cmd_move: Can't open file %s for writing
!cdiff_cmd_close: Can't apply MOVE due to conflict at line %d
!cdiff_cmd_move: Can't write to %s
!cdiff_cmd_move: No data was moved from %s to %s
!cdiff_cmd_move: Can't unlink %s
!cdiff_cmd_move: Can't rename %s to %s
/\100002053ClamAV-Diff:%*u:%u:#LSIZE#LSIZE %uwbabOPENADDDELXCHGCLOSEMOVEUNLINKbpbbbbbb%o%06octx malloc failedengine malloc failedfmap malloc failedfmap failed..%s/%scli_gentemp() failedERROR %s
!Can't open directory %s.
_vba_project%s/%s_%upowerpoint documentworddocument-------------- start of code ------------------
%s
-------------- end of code ------------------
!ScanDir -> Can't open directory %s.
!maxlinelen: Can't open file %s
!maxlinelen: Can't read file %s
!unpack: Couldn't find %s CLD/CVD database in %s
!unpack: Can't unpack file %s
!sha256file: Can't open file %s
!getdsig: Can't create socket
!getdsig: Can't connect to ClamAV Signing Service at %s
!getdsig: Can't write to socket
!getdsig: Error generating digital signature
!getdsig: Answer from remote server: %s
Signature received (length = %lu)
!getdsig: Communication error with remote server
!compare: Can't get MD5 checksum of %s
!compare: Can't allocate memory for 'obuff'
!compare: Can't allocate memory for 'nbuff'
!compare: Can't allocate memory for 'tbuff'
!compare: Can't open file %s for reading
!compare: New %s file contains lines terminated with CRLF or CR
!diffdirs: Can't open %s for writing
!diffdirs: Can't open directory %s
!listdb: Can't allocate memory for buffer
!listdb: Can't generate temporary name
!listdb: Can't create temporary directory %s
!listdb: Can't unpack CVD file %s
!listdb: Can't list directory %s
!listdb: Malformed pattern line %u (file %s)
!listdir: Can't open directory %s
!listdir: Can't allocate memory for dbfile
!listdb: Error listing database %s
!decodehexstr: Can't allocate memory for decoded
!decodehexstr: Unknown wildcard (0x%x@%u)
!decodehexspecial: strdup(hex) failed
!decodehexspecial: Can't allocate memory for buff
!decodehexspecial: Unexpected EOL
!decodehexspecial: Missing closing parethesis
!decodehexspecial: Empty block
{WILDCARD_ANY_STRING(LENGTH==%u)}{WILDCARD_ANY_STRING(LENGTH>=%u&&<=%u)}{WILDCARD_ANY_STRING(LENGTH>=%u)}{WILDCARD_ANY_STRING(LENGTH<=%u)}!Can't extract part %u of partial signature
!matchsig: Can't create new engine
!matchsig: cli_initroots() failed
!matchsig: Can't parse signature
!matchsig: Can't compile engine
!decodesig: Invalid or not supported signature format
!decodesig: Broken logical expression
!decodesig: Too many subsignatures
!decodesig: The number of subsignatures (==%u) doesn't match the IDs in the logical expression (==%u)
!decodesig: Invalid target type
decodesig: Not supported signature format
!vbadump: Can't generate temporary name
!vbadump: Can't create temporary directory %s
!dumpcerts: Can't create new engine
!dumpcerts: cli_initroots() failed
!dumpcerts: Can't parse signature
!dumpcerts: Can't compile engine
!dumpcerts: Can't open file %s!
!dumpcerts: fmap_need_off_once failed!
*dumpcerts: CL_CLEAN after cli_checkfp_pe()!
*dumpcerts: CL_VIRUS after cli_checkfp_pe()!
*dumpcerts: CL_BREAK after cli_checkfp_pe()!
!dumpcerts: Not a valid PE file!
!dumpcerts: Other error %d inside cli_checkfp_pe.
!verifydiff: Invalid diff name
!verifydiff: Incorrect info file %s
!verifydiff: Incorrect format of %s
!verifydiff: Can't generate SHA256 for %s
!verifydiff: %s has incorrect checksum
!rundiff: Incorrect file name (no .cdiff/.script extension)
--list-sigs: Can't get status of %s
--find-sigs: Can't compile regex
!hashsig: Can't access file %s
!hashsig: Can't generate hash for %s
!hashsig: Can't generate hash for input stream
!verifydiff: Incorrect file name (no .cdiff/.script extension)
!verifydiff: Can't generate temporary name for tempdir
!verifydiff: Can't create directory %s
!verifydiff: Can't unpack CVD file %s
!verifydiff: Can't copy dir %s to %s
!verifydiff: Can't open diff file %s
!verifydiff: Can't chdir to %s
^verifydiff: Can't chdir to %s
Verification: %s correctly applies to %s
Verification: %s correctly applies to the previous version
!makediff: --diff requires two arguments
!makediff: Can't read CVD header from %s
!makediff: The old CVD must be %u
!makediff: Can't generate temporary name for odir
!makediff: Can't create directory %s
!makediff: Can't unpack CVD file %s
!makediff: Can't generate temporary name for ndir
!Generated file is incorrect, removed!Generated file is incorrect, renamed to %s
Clam AntiVirus: Signature Tool (sigtool)  %s
       By The ClamAV Team: http://www.clamav.net/team
       (C) 2007-2009 Sourcefire, Inc. et al.

    --help                 -h              show help
    --version              -V              print version number and exit
    --quiet                                be quiet, output only error messages
    --debug                                enable debug messages
    --stdout                               write to stdout instead of stderr
    --hex-dump                             convert data from stdin to a hex
                                           string and print it on stdout
    --md5 [FILES]                          generate MD5 checksum from stdin
                                           or MD5 sigs for FILES
    --sha1 [FILES]                         generate SHA1 checksum from stdin
                                           or SHA1 sigs for FILES
    --sha256 [FILES]                       generate SHA256 checksum from stdin
                                           or SHA256 sigs for FILES
    --mdb [FILES]                          generate .mdb sigs
    --html-normalise=FILE                  create normalised parts of HTML file
    --utf16-decode=FILE                    decode UTF16 encoded files
    --info=FILE            -i FILE         print database information
    --build=NAME [cvd] -b NAME             build a CVD file
    --max-bad-sigs=NUMBER                  Maximum number of mismatched signatures
                                           when building a CVD. Default: 3000
    --flevel=FLEVEL                        Specify a custom flevel.
                                           Default: %u
    --cvd-version=NUMBER                   Specify the version number to use for
                                           the build. Default is to use the value+1
                                           from the current CVD in --datadir.
                                           If no datafile is found the default
                                           behaviour is to prompt for a version
                                           number, this switch will prevent the
                                           prompt.  NOTE: If a CVD is found in the
                                           --datadir its version+1 is used and
                                           this value is ignored.
    --no-cdiff                             Don't generate .cdiff file
    --unsigned                             Create unsigned database file (.cud)
    --print-certs=FILE                     Print Authenticode details from a PE
    --server=ADDR                          ClamAV Signing Service address
    --datadir=DIR                          Use DIR as default database directory
    --unpack=FILE          -u FILE         Unpack a CVD/CLD file
    --unpack-current=SHORTNAME             Unpack local CVD/CLD into cwd
    --list-sigs[=FILE]     -l[FILE]        List signature names
    --find-sigs=REGEX      -fREGEX         Find signatures matching REGEX
    --decode-sigs                          Decode signatures from stdin
    --test-sigs=DATABASE TARGET_FILE       Test signatures from DATABASE against 
                                           TARGET_FILE
    --vba=FILE                             Extract VBA/Word6 macro code
    --vba-hex=FILE                         Extract Word6 macro code with hex values
    --diff=OLD NEW         -d OLD NEW      Create diff for OLD and NEW CVDs
    --compare=OLD NEW      -c OLD NEW      Show diff between OLD and NEW files in
                                           cdiff format
    --run-cdiff=FILE       -r FILE         Execute update script FILE in cwd
    --verify-cdiff=DIFF CVD/CLD            Verify DIFF against CVD/CLD
!Can't initialize libclamav: %s
!Can't parse command line options
!hexdump: Can't write to stdout
!htmlnorm: Can't open file %s
!utf16decode: Can't open file %s
!utf16decode: Can't allocate memory
!utf16decode: Can't create file %s
!utf16decode: Can't write to file %s
!build: --server is required for --build
!build: COPYING file not found in current working directory.
!build: Can't initialize antivirus engine
!build: Can't load database: %s
!build: There are no signatures in database files
!build: Can't open current directory
!build: Memory allocation error
!build: dblist2 == NULL (no .cbc files?)
^build: Signatures in %s db files: %u, loaded by libclamav: %u
!Bad number of signatures in database files
!build: Not a CVD/CLD/CUD file
^build: CAN'T READ CVD HEADER OF CURRENT DATABASE %s (wait 3 s)
!build: Can't get builder name
!writeinfo: Can't create file %s
!writeinfo: Can't write to %s
!writeinfo: Can't generate SHA256 for %s
!writeinfo: Can't write to info file
!writeinfo: Can't get digital signature from remote server
!build: Can't generate info file
!build: Can't generate temporary name for tarfile
!build: Can't open file %s for writing
!build: Can't add COPYING to tar archive
!build: Can't open file %s for reading
!build: Can't generate MD5 checksum for %s
!build: Can't get digital signature from remote server
!build: Can't create final database %s
!build: Can't generate temporary name
!build: Can't create temporary directory %s
!build: Can't unpack CVD file %s
!script2diff: Can't stat file %s
!script2cdiff: Incorrect file name (no .script extension)
!script2cdiff: Incorrect file name syntax
!script2cdiff: Can't open %s for writing
!script2cdiff: Can't write to %s
!script2cdiff: Can't open file %s for reading
!script2cdiff: Can't open file %s for appending
!script2cdiff: Can't gzwrite to %s
!script2cdiff: Can't open %s for reading/writing
!script2cdiff: Can't get digital signature from remote server
!script2cdiff: Can't open %s for appending
!cvdinfo: Can't read/parse CVD header of %s
Verification: Unsigned container
!--test-sigs requires two arguments
!testsigs: Can't open file %s
!makediff: --compare requires two arguments
!--verify-cdiff requires two arguments
--verify-cdiff: Can't get status of %s
%s/%s.cvd%s/%s.cld%02xSIGNDPASSPassword: !getdsig: tcgetattr() failed
!getdsig: tcsetattr() failed
%as!getdsig: Can't get password
socket()connect()ClamSign:%s:%s:ClamSignPSS:%s:%s:ClamSignPSS2:%s:%s:Signature:#LSIZE %u
OPEN %s
ADD %s
DEL %u %s
XCHG %u %s %s
CLOSE
UNLINK %s
!diffdirs: getcwd() failed
!diffdirs: Can't chdir to %s
^diffdirs: Can't chdir to %s
Generated diff file %s
!listdb: Can't open file %s
!listdb: fgets failed
ClamAV-VDB:!listdb: Invalid filename %s
.db[%s] %s
 (Clam).crb.hdu.mdb.mdu.hsb.hsu.msb.msu.ndb.ndu.ldb.ldu.sdb.zmd.rmd.cdb.cbc[%s BYTECODE] %s{WILDCARD_NIBBLE_HIGH:0x%x}{WILDCARD_NIBBLE_LOW:0x%x}!Decoding failed (1): %s
|!Decoding failed (2)
!Decoding failed
{WILDCARD_ANY_STRING}-*testmatch at offsetmatches at offsets/CHECK OFFSETMATCH: ** YES%s ** (%u %s:MATCH: ** NO **
!decodesig: Invalid input
VIRUS NAME: %s
.{TDB: %s
LOGICAL EXPRESSION: %s
 * BYTECODE SUBSIG
 * SUBSIG ID %d
 +-> OFFSET: %s
 +-> OFFSET: ANY
 +-> DECODED SUBSIGNATURE:
 +-> TOKENS COUNT: %u
FUNCTIONALITY LEVEL: >=%s
FUNCTIONALITY LEVEL: %s..%s
TARGET TYPE: ANY FILE
PE
OLE2
HTML
MAIL
GRAPHICS
ELF
NORMALIZED ASCII TEXT
DISASM DATA
MACHO
PDF
FLASH
JAVA CLASS
DECODED SIGNATURE:
!vbadump: Can't open file %s
!dumpcerts: No filename!
deadbeef!verifydiff: strdup() failed
%s.info!verifydiff: Can't open %s
ClamAV-VDBDSIG.cdiff!rundiff: Can't open file %s
hashsig%u:%s:%s
%s:%u:%s
!verifydiff: getcwd() failed
!verifydiff: Can't apply %s
%s-%u.script%s.broken!fmap failed
%s.asciiCOPYINGlast.hdb%s.%s%s/%s.cudVersion number: !build: scanf() failed
Total sigs: %u
New sigs: %u
C%d %b %Y %H-%M %zX:X:SIGNDUSERBuilder name: :%u!writeinfo: Can't unlink %s
wb+DSIG:%s
wb9fbytecode.info!build: Can't write to %s
^build: Can't unlink %s
Created %s
Skipping .cdiff creation
ClamAV-Diff:%u:%u:ab9f:%sFile: %s
Build time: %s
Version: %u
Signatures: %u
Functionality level: %u
Builder: %s
MD5: %s
Digital signature: %s
!cvdinfo: Verification: %s
Verification OK.
cfgignign2ftmidbsfpgdbpdbwdb}MMMNN(N9NJN[NlN}NNN/UY]b(f.=Bv8GLQV[`ejofkjnrv);8FP(pX#(*(X*D*`*(++x-X/H5,FLFdG|GHXJhJJM0NPHPtQQS(TTU4aT8btXchorss4wTH~tXx,LXl(	H,	XL	h		H			
h(
H
h
x


|PAB
E8ЦAB
IXjAB
Ix07AB
pAB
I@AB
F@AB
F'AB
A'AB
A(0MAB
ACHOAB
EhAB
F sAB
ACF  AB
FHH AB
ACFAB
I
AG
,AB
DAB
BI dP#AB
IIIqAB
F	AB
IAB
`]AB
LAB
F HAB
KFF<AB
A XAB
FEE|=AB
FAB
FAG
JpAG
K`_AB
IAD
K<AD
K\AB
F|AB
F@-AB
Ip	PAB
FF	AB
S
AB
I`AB
I<AB
I\AB
t 5AB
AD`AB
LE@xAB
BCAB
C ~AB
F@(AB
I4,KAB
FTP4oAB
Ft7AB
C9qAB
BF0AAB
CFAB
ADIAB
CPAB
G0PAB
CPPRAB
IpUAB
IXAB
IHYAB
BC`[AB
BF]|AB
AJaAB
I0peAB
(H hC-D	FAB
DzR|AB
8iAB
Cw>p
ohȁ
zpP ooo2Λޛ.>N^n~Μޜ.>N^n~Νޝ.>N^n~Ξޞ.>N^n~Οޟ.>N^n~Πޠ.>N^n~Ρޡ.>N^n~΢ޢ.>N^n~Σޣ.>N^n~Τޤ.>N^n~dGCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54)GCC: (GNU) 4.1.2 20080704 (Red Hat 4.1.2-54).symtab.strtab.shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.comment44#HH 1ohh`;ȁ
CzKo22^Xog	PP p	ppyppt
%x@@h <!!!!""HH%d% d%V',-p]	Aĥ-:HWmPy@0Ms 
'3=Ab`J[ipx
 5`@x ~@(
,KP4o7)9q:0ADFMIWPbPjPRtUXY`[]|ape	-@4Hhȁ2Pp	p

@HI4[]wH Izv2=.>pNlLv.{J	p	PId4=Yt  H@nD5!;W]_gqv
<rz	"0qAKSqo='CE1
;H[do'PO	z-	?	`	Wz				D		
+
;
DQ
pZ
g
	p
x
A
N
=
@-
H

Ц
6W/TBQ<c=s<9*'<Xj2{958H

2
"D
U
b
ir
|
9

4
b
T

+
a7[RNf`]qo_81 R|#Da
mdyPBC\)0K\kh|'_
v*6HM_oED`P#||#45I2dw?*9f`_`R,=QEe8jd807%@W*X1WR?czq hC-p
N]call_gmon_start__CTOR_LIST____DTOR_LIST____JCR_LIST__dtor_idx.5793completed.5791__do_global_dtors_auxframe_dummy__CTOR_END____FRAME_END____JCR_END____do_global_ctors_auxfacilitymapcharind.3503_getopt_internaloptget_ioptaddoptaddargcnt.19528fs.19530buff.19527cdiff_ctx_freecdiff_tokencdiff_executecommandscdiff_cmd_unlinkcdiff_cmd_addcdiff_cmd_opencdiff_cmd_delcdiff_cmd_xchgcdiff_cmd_closecdiff_cmd_movesigtool_scandirmaxlinelenqcompareunpackgetdbnamesha256filegetdsigcomparediffdirslistdblistdirdecodehexstrdecodehexspecialdecodehexmatchsigdecodesigdecodesigsvbadumpdumpcertscomparesharundifflistsigshashsigverifydiffmakediffhelpdblist__preinit_array_start__fini_array_end_GLOBAL_OFFSET_TABLE___preinit_array_end__fini_array_start__init_array_end__init_array_start_DYNAMICfileno@@GLIBC_2.0cli_regcomp@@CLAMAV_PRIVATEdata_startfputs@@GLIBC_2.0__errno_location@@GLIBC_2.0cl_init@@CLAMAV_PUBLICmprintf_quietopen@@GLIBC_2.0connect@@GLIBC_2.0localtime_r@@GLIBC_2.0mkdir@@GLIBC_2.0mprintf_stdoutmprintf_verbose__libc_csu_finicli_parse_add@@CLAMAV_PRIVATElogg_lockqsort@@GLIBC_2.0cli_gentemp@@CLAMAV_PRIVATEcli_hashfile@@CLAMAV_PRIVATE_startcli_wm_readdir@@CLAMAV_PRIVATEdestroy_ctxcheck_flevelcl_load@@CLAMAV_PUBLICcli_cvdunpack@@CLAMAV_PRIVATEcl_initialize_crypto@@CLAMAV_PRIVATE__fprintf_chk@@GLIBC_2.3.4uniq_get@@CLAMAV_PRIVATE__gmon_start___Jv_RegisterClassesfilelist_fp_hwrealloc@@GLIBC_2.0rewind@@GLIBC_2.0__xstat64@@GLIBC_2.2localtime@@GLIBC_2.0gzopenEVP_sha256__printf_chk@@GLIBC_2.3.4cli_str2hex@@CLAMAV_PRIVATEgzclosestrchr@@GLIBC_2.0recv@@GLIBC_2.0getenv@@GLIBC_2.0_finicalloc@@GLIBC_2.0inet_addr@@GLIBC_2.0strncpy@@GLIBC_2.0mprintf_disabledcl_engine_new@@CLAMAV_PUBLICwrite@@GLIBC_2.0convenience_ctxprintinfectedfgets@@GLIBC_2.0EVP_MD_CTX_createcl_hash_init@@CLAMAV_PUBLICrename@@GLIBC_2.0cl_hash_destroy@@CLAMAV_PUBLIClogg_syslogmemset@@GLIBC_2.0logg_time__strtol_internal@@GLIBC_2.0setsid@@GLIBC_2.0optoptcli_vba_readdir@@CLAMAV_PRIVATE__libc_start_main@@GLIBC_2.0logg_verbosestrrchr@@GLIBC_2.0optparseoptadditemmy_getopt_long_onlycli_hashstream@@CLAMAV_PRIVATEmprintf_send_timeouttcgetattr@@GLIBC_2.0print_versionoptget__vsnprintf_chk@@GLIBC_2.3.4cli_ac_chklsig@@CLAMAV_PRIVATEread@@GLIBC_2.0perror@@GLIBC_2.0cli_utf16toascii@@CLAMAV_PRIVATE__strcat_chk@@GLIBC_2.3.4cli_regexec@@CLAMAV_PRIVATEreaddir@@GLIBC_2.0cl_cleanup_crypto@@CLAMAV_PRIVATE_IO_stdin_usedfdopen@@GLIBC_2.1cli_wm_decrypt_macro@@CLAMAV_PRIVATEcli_chomp@@CLAMAV_PRIVATEfree@@GLIBC_2.0__lxstat64@@GLIBC_2.2mdprintflogg_noflushfilecopygzwritescanf@@GLIBC_2.0cl_update_hash@@CLAMAV_PUBLICaccess@@GLIBC_2.0tar_addfile__data_startrecursionmprintfcli_checkfp_pe@@CLAMAV_PRIVATEfflush@@GLIBC_2.0cl_cvdfree@@CLAMAV_PUBLICopendir@@GLIBC_2.0cli_is_abspathsocket@@GLIBC_2.0dup2@@GLIBC_2.0__ctype_b_loc@@GLIBC_2.3fseek@@GLIBC_2.0gzdopenlogg_fpumask@@GLIBC_2.0fclose@@GLIBC_2.1dup@@GLIBC_2.0cli_calloc@@CLAMAV_PRIVATEcl_engine_free@@CLAMAV_PUBLICstderr@@GLIBC_2.0memcpy@@GLIBC_2.0cli_regfree@@CLAMAV_PRIVATEstrlen@@GLIBC_2.0fopen@@GLIBC_2.1unlink@@GLIBC_2.0cl_cvdhead@@CLAMAV_PUBLICcl_engine_set_num@@CLAMAV_PUBLIChtml_normalise_map@@CLAMAV_PRIVATEcountlines__dso_handlesetlocale@@GLIBC_2.0__xpg_basename@@GLIBC_2.0strcpy@@GLIBC_2.0ftell@@GLIBC_2.0__DTOR_END____libc_csu_initlogg_filechdir@@GLIBC_2.0ctime@@GLIBC_2.0EVP_MD_CTX_destroystrcasecmp@@GLIBC_2.0optindbell__syslog_chk@@GLIBC_2.4cli_ctime@@CLAMAV_PRIVATEselect@@GLIBC_2.0cli_strbcasestr@@CLAMAV_PRIVATEcli_rmdirs@@CLAMAV_PRIVATEclosedir@@GLIBC_2.0freshdbdirclose@@GLIBC_2.0fwrite@@GLIBC_2.0__clam_optionsstrstr@@GLIBC_2.0cli_vba_inflate@@CLAMAV_PRIVATEtime@@GLIBC_2.0cli_gettmpdir@@CLAMAV_PRIVATEcli_strtokenize@@CLAMAV_PRIVATEcli_ole2_extract@@CLAMAV_PRIVATEcli_filecopy@@CLAMAV_PRIVATEget_version__bss_startmalloc@@GLIBC_2.0logg_facilitycl_sha1@@CLAMAV_PRIVATE__stack_chk_fail@@GLIBC_2.4logg_rotateclam_optionsfputc@@GLIBC_2.0cli_initroots@@CLAMAV_PRIVATEcl_strerror@@CLAMAV_PUBLICcl_retdbdir@@CLAMAV_PUBLICstdin@@GLIBC_2.0mprintf_nowarnsleep@@GLIBC_2.0cl_debug@@CLAMAV_PUBLICmy_getopt_longcl_finish_hash@@CLAMAV_PUBLICcli_fmap_scandesc@@CLAMAV_PRIVATEcl_retflevel@@CLAMAV_PUBLICcli_hex2ui@@CLAMAV_PRIVATEsend@@GLIBC_2.0logg_nowarngetcwd@@GLIBC_2.0_endstdout@@GLIBC_2.0puts@@GLIBC_2.0__strtoul_internal@@GLIBC_2.0fork@@GLIBC_2.0__fxstat64@@GLIBC_2.2optfreesigtool_vba_scandirmatch_regextcsetattr@@GLIBC_2.0fcntl@@GLIBC_2.0cli_malloc@@CLAMAV_PRIVATEgzgetssscanf@@GLIBC_2.0__fxstat@@GLIBC_2.0__sprintf_chk@@GLIBC_2.3.4strncmp@@GLIBC_2.0lseek@@GLIBC_2.0cli_versig2@@CLAMAV_PRIVATE__snprintf_chk@@GLIBC_2.3.4EVP_DigestInit_exstrpbrk@@GLIBC_2.0EVP_DigestFinal_excdiff_applyprintcleancli_isnumber@@CLAMAV_PRIVATEfread@@GLIBC_2.0closelog@@GLIBC_2.0strftime@@GLIBC_2.0cl_engine_compile@@CLAMAV_PUBLIClogg_edatafmap@@CLAMAV_PRIVATElogg_closecl_cvdverify@@CLAMAV_PUBLICstrcmp@@GLIBC_2.0my_getopt__strdup@@GLIBC_2.0exit@@GLIBC_2.0cli_hex2str@@CLAMAV_PRIVATEopterrcli_ppt_vba_read@@CLAMAV_PRIVATEEVP_DigestUpdate__i686.get_pc_thunk.bxoptarglogg_sizedaemonizemain_initlogg_foregroundcli_strtok@@CLAMAV_PRIVATE